facebook com

Địa danh có tên miền dài nhất thế giới


Kỷ lục này thuộc về ngôi làng trên đảo Anglesey của xứ Wales với cái tên dài tới 58 ký tự không chứa dấu cách.



Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch (gọi tắt là Llanfair PG) có nghĩa "nhà thờ thánh Mary tại thung lũng cây phỉ trắng gần xoáy nước và nhà thờ thánh Tysilio".

Tên miền Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com đã được hãng Internetters đăng ký vào ngày 21/10/1999 và đây trở thành domain địa danh dài nhất.

Do tên miền .com không được phép dài quá 67 ký tự, nó không đủ chỗ để thị trấn Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwhenuakitanatahu tại New Zealand (85 chữ cái) phá kỷ lục của Llanfair PG. Cái tên này được hiểu là "Ngọn đồi nơi Tamatea - người đàn ông có đầu gối to, người leo núi, con chim nhạn của đất liền - thổi sáo cho người mình yêu".

Tuy nhiên, địa danh này cũng chưa là gì so với Krungthepmahanakornamornratanakosin
phimarnavatarnsathitsakkattiyavisanukamprasit ở Thái Lan (163 ký tự).

Ngoài ra, việc giới hạn tên miền trong 63 ký tự (thêm .com là 67) đã khiến người sử dụng Internet đua nhau đăng ký những domain ngộ nghĩnh như:



Bài Hay Đừng Ngại Like Ngay!
4589 lượt xem

Cập nhật nhanh bài hay

Đã kinh doanh thì phải cập nhật nhanh những tin sốt dẻo!
Hãy đăng ký nhận ngay bài hay & những ưu đãi bất ngờ từ Mắt Bão.
loading matbao